- SLC6A18 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82024
- Rabbit
- Human
- Unconjugated
- SLC6A18
- This antibody was developed against Recombinant Protein corresponding to amino acids: GFKATNDYEH CLDRNILSLI NDFDFPEQSI SRDDYPAVLM HLNATWPKRV AQLPLKACLL EDFLDKSASG PGLAFVVFTE TDL
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Xtrp2
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- solute carrier family 6 member 18
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer, Endocrinology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
Specifications/Features
Available conjugates: Unconjugated